PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013613960.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 803aa    MW: 91089.6 Da    PI: 5.1369
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013613960.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.71.1e-07416460246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g+WT+eE+  l   +++    +W  Ia  +g++Rt+ qc  r+q 
   XP_013613960.1 416 GPWTAEEENNLRLIIQEKEFTDWLDIAVSLGTNRTPFQCLARYQR 460
                      89*****************************************96 PP

2Myb_DNA-binding45.91.3e-14468514148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      r+ WT+eEd++l  av+++G ++W t+a+ +  gR + qc +rw k l
   XP_013613960.1 468 RKEWTAEEDDQLRAAVELYGEKDWQTVANALE-GRAGTQCSNRWKKTL 514
                      789*****************************.***********9975 PP

3Myb_DNA-binding48.91.5e-15522566247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g+++ eE+++l+ av+++G  +W++Iar ++ gRt  qc+++w + 
   XP_013613960.1 522 GKFSSEEEKRLKVAVTLFGAQNWHKIARFVP-GRTSTQCREKWANC 566
                      79*****************************.***********885 PP

4Myb_DNA-binding53.65.1e-17574618247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g+W++eEd +l +a +++  g+W++Ia++++ +Rt++qc+ rw ++
   XP_013613960.1 574 GKWSKEEDAKLREAMAEHEIGNWSKIASHVP-RRTDNQCRRRWMQL 618
                      89*****************************.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.075313405IPR017877Myb-like domain
SMARTSM007170.12317411IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.5E-9320336IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.5E-9382421IPR009057Homeodomain-like
SuperFamilySSF466896.25E-13391459IPR009057Homeodomain-like
PROSITE profilePS500908.269410462IPR017877Myb-like domain
SMARTSM007173.0E-7414464IPR001005SANT/Myb domain
PfamPF002493.5E-7416460IPR001005SANT/Myb domain
CDDcd001677.09E-5417462No hitNo description
Gene3DG3DSA:1.10.10.601.7E-12422472IPR009057Homeodomain-like
SuperFamilySSF466892.23E-19447517IPR009057Homeodomain-like
PROSITE profilePS5129421.822463518IPR017930Myb domain
SMARTSM007176.1E-14467516IPR001005SANT/Myb domain
PfamPF002491.6E-12468513IPR001005SANT/Myb domain
CDDcd001673.82E-11470514No hitNo description
Gene3DG3DSA:1.10.10.602.8E-16473517IPR009057Homeodomain-like
PROSITE profilePS5129412.618519567IPR017930Myb domain
SMARTSM007174.0E-12520569IPR001005SANT/Myb domain
PfamPF002493.1E-13522566IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-17522571IPR009057Homeodomain-like
CDDcd001671.99E-10523565No hitNo description
SuperFamilySSF466895.03E-26547622IPR009057Homeodomain-like
PROSITE profilePS5129425.519568623IPR017930Myb domain
SMARTSM007174.5E-15572621IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-21572618IPR009057Homeodomain-like
PfamPF002494.5E-16574618IPR001005SANT/Myb domain
CDDcd001672.25E-14575618No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 803 aa     Download sequence    Send to blast
MNRGALYESE DDDDEEEDDD IGEDLEDLRR ACIVPESNSD DVIAKSGEGG GGGGGGEIPS  60
DSENEDDFEM LRNLKSQLAS STGPPVGLPL PSDSESDDDF ELLRSLKSQL ALSMDARLPP  120
MSLSDDDDED DDSFETLRAI RRRLSAYANL DPDGAFMNDS LGKKKQGGKV VTLPDSIQAG  180
VSVDLHENNA TAPLDQSSSF PEAAQAFVEA IRRNRAYQKF LRKKLTEIEA KIEQNEKHQK  240
NVKIVVDFQA SCKRITKQTL SQGRDPRLQL ISTPKCGPRD SSEDNDKKIS PLTFGPPENS  300
RVENYRMAVK NYPVSVNRRS WSTEENENLA KGLKQQLQET LLNEAIERSS DLEGSTDDID  360
AINESIKNLE ITPEMIRQFL PKVNWDQLAS MYFKDRSAAE CEARWISSED PLINHGPWTA  420
EEENNLRLII QEKEFTDWLD IAVSLGTNRT PFQCLARYQR SLNADILRKE WTAEEDDQLR  480
AAVELYGEKD WQTVANALEG RAGTQCSNRW KKTLHPTRTR VGKFSSEEEK RLKVAVTLFG  540
AQNWHKIARF VPGRTSTQCR EKWANCLDPN VNHGKWSKEE DAKLREAMAE HEIGNWSKIA  600
SHVPRRTDNQ CRRRWMQLYP HQVPLLQEAT RLRKEAIVGN FVDRESQRPA LLECKFLALP  660
EIPLEPEPEI VVVKKKRKAR PKKADAECES EESSAAKERR PKRRRKGLER CSGDVCRQEN  720
ETVCENIENL DNGGEVRSLE WYKENQDNVK EKKQRRRRKS VAETSNNSTV TTDCSQVKVG  780
VKKLTPRRKV SAVVPVENQD APN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-273846153155MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-273846153155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013613960.10.0PREDICTED: snRNA-activating protein complex subunit 4-like isoform X2
TrEMBLA0A0D2ZRC10.0A0A0D2ZRC1_BRAOL; Uncharacterized protein
STRINGBra022280.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.10.0myb domain protein 4r1